Immagine che descrive in maniera fumettistica Billy meier che 'parla' con i Plejaren!
Immagine dell'Unico e Vero simbolo di Pace
📜 Rapporti dei Contatti
Rubriche
& Temi:
 

Il calcolo del Pi Greco π: un errore che dura da secoli

Una lavagna nera sulla quale é riportato il valore del Pi Greco fino all'ennesima cifra
Il valore del Pi Greco (π) necessita di una revisione seria ed accurata

In modo del tutto irresponsabile, nonostante i dati a disposizione da anni, nel mondo scientifico internazionale ancora non si è voluto comprendere e riconoscere il fatto che il valore del π attualmente in uso sia errato. Con tutte le conseguenze che questo comporta, come può essere constatato nell’articolo qui riportato.

Valore sbagliato in uso: 3,14159 26…
Valore corretto: 3,1446055…

 

 

INFORMAZIONI IMPORTANTI CIRCA IL NUMERO Pi Greco π

Chiunque abbia un'istruzione superiore e/o lavori in un campo tecnico è a conoscenza del numero π (“Pi Greco”) come parte della sua istruzione o attività. Questo cosiddetto "rapporto circolare", che è nelle formule rappresentato appunto dalla lettera greca π (Pi), è il rapporto tra la circonferenza e il diametro di un cerchio ed è un fattore di calcolo fondamentale in molti campi fisico-scientifici, dall'architettura all'astrofisica e alla fisica quantistica, ecc. Per chi è interessato alla storia di questo numero, si consiglia di cercare le rispettive informazioni direttamente su internet.

In matematica e in generale nelle scienze ingegneristiche vi è accordo sul fatto che il rapporto circolare corrisponde al valore 3,1415 ... (i tre punti indicano che le quattro cifre dopo il punto sono seguite da moltissime altre). Nello specifico, il rapporto circolare π sta a significare che per un cerchio di 1 metro di diametro la sua circonferenza è di 3,1415 ... metri, il che purtroppo è totalmente sbagliato, perché questo valore è sbagliato! Ma ci sono buone notizie: il rapporto circolare corretto, vale a dire 3,1446 ..., nel frattempo è stato determinato e la sua correttezza dimostrata da Harry E. Lear, Idaho-USA. Colgo l'occasione a seguito della sua visita in data 3 settembre 2017 presso il Semjase Silver Star Center (SSSC), assieme alla moglie Nancy, per spiegare la vicenda passata che ha portato a questo evento memorabile, visto da una prospettiva storica scientifica, cioè il calcolo del risultato esatto.

Ancora una volta si rende evidente che, grazie alle informazioni preziose ed estremamente articolate che "Billy" Eduard A. Meier (BEAM) e i suoi amici Plejaren (tra cui anche le altre personalità appartenenti alla famiglia/discendenza della forma spirituale Nokodemion) impartiscono o hanno impartito, sono state messe in moto cose rivoluzionarie, che hanno già portato e continueranno a portare risultati positivi incommensurabili.

Per descrivere la sequenza che aveva alla fine portato alla correzione del valore del π, devo andare un po’ oltre e comincio quindi con il 127° Rapporto di Contatto del 3 febbraio 1980 (Rapporti di Contatto, Volume 3, pagina 433):

Billy:
Allora qualcosa sorgerà, davvero, presto. Ma ora, un'altra domanda: molto tempo fa, una volta ti ho chiesto il numero totale di tutti gli elementi esistenti nell'universo. A quel tempo, mi hai detto che non ti era permesso fornire alcuna informazione al riguardo, a meno che il numero esatto non fosse scoperto dagli esseri umani stessi della Terra. Ora, di nuovo, ritorno alla domanda sul numero degli elementi e aggiungo: c'è una qualche stella nell'universo, dove tutti questi elementi si trovano insieme?

Semjase:
Non esiste una stella del genere, perché sarebbe contro le Leggi della Creazione.

Billy:
Ah bene. È giusto affermare che il numero totale di elementi sia 280? (n.d.t.: al momento, 2020, secondo quanto conosciuto dagli scienziati terrestri ne esistono 118…!!)

Semjase:
Come ci sei arrivato a questo risultato?

Billy:
Non sono stato io, ragazza mia, ma Guido. Da parte mia, ho solo calcolato che questo numero deve essere corretto, perché ho scoperto che questo numero, moltiplicato sette volte per l'altezza originale della piramide di Giza, porta al valore attuale della velocità della luce alla decima cifra decimale.

Semjase:
Sei semplicemente incredibile. Il numero degli elementi è corretto come anche il tuo calcolo con la moltiplicazione di sette volte dell'altezza della piramide originale. Il risultato finale produce effettivamente il numero esatto della “costante” della velocità della luce al momento attuale (n.d.t.: la velocità della luce, che corrisponde alla velocità di espansione della Creazione, che attualmente è in fase espansiva dal momento del “Big Bang”, è in costante rallentamento. La Creazione si espande rallentando istante per istante la propria velocità di espansione. Conclusa la fase di espansione, la Creazione avrà una successiva fase di contrazione fino a raggiungere nuovamente la condizione iniziale del Big Bang).

Billy:
Come Guido sia effettivamente arrivato al valore di 280, non lo so esattamente. Mi ha scritto solo una formula di calcolo. È importante che lì, tuttavia, il numero base di 280, con cui ho potuto effettuare ulteriori calcoli e fare alcuni controlli, sia corretto. Quindi ho semplicemente preso il valore dell’altezza della piramide (n.d.t: si tratta del valore “vero” dell’altezza della piramide di Cheope come era in origine, prima che gli agenti atmosferici e altre interazioni nel corso dei secoli ne alterassero il valore), moltiplicandolo per questo 280, a sua volta moltiplicato per sette, e da questo è derivato il risultato della velocità della luce.

Semjase:
Tuttavia, non dovresti ancora rendere noti questi risultati.

Billy:
Vuoi dire che dovrei tacere al riguardo?

Semjase:
Certo, almeno sui valori numerici dell'altezza reale della piramide originale. Fino ad ora, questo dato è ancora sconosciuto agli scienziati terrestri di certi campi del sapere, e non sarebbe bene se li conoscessero già adesso.
Tra due o tre anni, tuttavia, il fatto che questo numero venga divulgato non giocherà più un ruolo importante. Fino ad allora, tuttavia, dovresti stare attento.

Billy:
Finora, coloro che si occupano di queste cose disponevano di dati completamente sbagliati riguardo all'altezza della piramide, il che ha portato a conclusioni sbagliate e ulteriori risultati sbagliati.

Semjase:
Certo, ma tutte queste cose sono molto più ramificate di quanto tu possa immaginare in questo momento. I dati della piramide hanno implicazioni che si estendono alla fisica e a molte altre scienze. E questi dati forniscono formule di base per calcoli molto specifici, che portano a enormi invenzioni di tutti i tipi e a enormi progressi. Ma se queste invenzioni e progressi venissero avviati ora proprio impiegando questi dati corretti, allora il particolare percorso evolutivo (n.d.t.: dei terrestri) ne sarebbe disturbato, nel senso che sarebbe innescata una catastrofe sulla Terra dagli esseri umani della Terra ancora più grande di quanto potrebbe avvenire in futuro. La comunicazione dei dati corretti porterebbe a calcoli e scoperte che indicherebbero alle scienze terrestri modi e possibilità di cui essi non sono ancora padroni e che pertanto potrebbero solo finire in una catastrofe senza speranza.

Billy:
Capisco, quindi devo fare attenzione a che nessun membro del gruppo divulghi questi dati, poiché una o due persone ne sono a conoscenza.

Semjase:
È imperativo che tu ricordi loro di mantenere il silenzio necessario.

Billy:
Lo farò. Ma questo si riferisce solo ai dati della piramide, giusto?

Semjase:
Certamente, riguarda solo quello

Molti anni dopo, il 19 giugno 1993 e durante la 246^ conversazione di contatto (Rapporti di Contatto, Volume 7, pagina 189 e seguenti), Billy fece riferimento alla conversazione precedente:

Billy:
ancora un’altra domanda: una volta mi hai spiegato che nell'intero universo esistono 280 elementi, dopo che Guido ha ottenuto questo datoattraverso dei calcoli. Ho quindi calcolato che l'altezza originale della piramide della Piramide di Giza era di 152,955347 metri, come mi hai confermato. Hai anche affermato a tale riguardo che l'altezza odierna di circa 136,8 metri è dovuta al fatto che gli antichi egizi, ecc., rimossero così tanto materiale dalla piramide tale si ridusse di conseguenza.
Ebbene, gli scienziati terrestri affermano che la Grande Piramide di Giza originariamente aveva un'altezza di 146,6 metri, il che però, secondo i miei calcoli e le vostre affermazioni, non corrisponde affatto alla verità. L'altezza originaria in realtà ammontava a 152,955347 metri, che, trasposta in chilometri, corrisponde esattamente alla distanza Terra-Sole (n.d.t: 152΄955΄347 milioni di chilometri) e quindi a 1 au, cioè una unità astronomica. Fatto, questo, che contraddice l'inesatta misurazione della distanza Terra-Sole da parte della scienza terrestre-astronomica. È interessante ora il calcolo aggiuntivo che avevo fatto in quel momento, e cioè che è possibile calcolare la velocità della luce di oggi e in modo molto accurato dalla precisa altezza della piramide, quindi dalla distanza precisa Terra-Sole e con il numero totale di elementi di 280, se si include il fattore di moltiplicazione 7. Il calcolo si legge quindi come segue:

280 (n.d.t: numero degli elementi presenti nella Creazione =7 x 40) x 7 (numero ricorrente caratteristico della Creazione) =1960

1960 x 152,955347 (n.d.t.: altezza in metri della piramide di Cheope o, trasposta, la distanza in km Terra – Sole)= 299΄792,48012 (n.d.t: velocità della luce/espansione della creazione in km/s)

Quindi il risultato finale è la velocità della luce di oggi, che è di 299 mila e 792,48012 chilometri al secondo. A quel tempo non ero autorizzato a pubblicizzare questo calcolo né il numero esatto di elementi. La domanda ora è se questi calcoli che ho fatto debbano ancora essere mantenuti riservati o se se ne possa parlare apertamente.

Ptaah:
Non ci sono più ragioni per ulteriore riservatezza.

Poi, il 3 febbraio 1995, durante il 251° contatto, BEAM ha aggiunto 23 pagine con profezie e predizioni al verbale di contatto, dove si riferiva alla necessità di correggere il "numero π" come segue (Resoconto dei Contatti, volume 7, pagine 336 e 340):

“… Questi eventi coincidono con molte innovazioni e scoperte nella tecnologia e nella scienza; per il 1995 e gli anni successivi si registrano scoperte incredibili che cambieranno la civiltà. Un fattore che contribuirà a queste scoperte nel prossimo futuro sarà, infine, l'esposizione e la rettifica di un errore nel calcolo del numero π ... Solo allora le persone realizzeranno correttamente che il Sole è un corpo celeste morente e che, conseguentemente, la fine del sistema SOL è di fatto già predeterminata. Tuttavia, il Sole continuerà ad esistere per circa 4,1 miliardi di anni, ma per quel tempo sarà una stella morta che, alla fine, sarà inghiottita e distrutta da un buco nero. Quindi gli scienziati inizieranno a conseguire i risultati migliori e così facendo troveranno i calcoli errati su cui si basa il numero π. Eliminando l'errore in π e correggendo futuri calcoli basati su questo, gli scienziati e la loro straordinaria tecnologia altamente sviluppata avranno la capacità di rendere accessibili per le persone della Terra energie inimmaginabili, cioè questa correzione permetterà loro di ricavare energie dai buchi neri posti nella vasta area della Via Lattea e renderle utilizzabili per la Terra.

Gli scienziati in quel periodo, tuttavia, non saranno ancora in grado di viaggiare al centro della nostra Galassia per attingere al buco nero esistente in quella regione. Tuttavia, non sarà necessario andare al centro della nostra Galassia, almeno in quel particolare momento, poiché gli oggetti vicini produrranno energia sufficiente per soddisfare i bisogni della Terra. Questa nuova fonte di energia, così come il tipo stesso di energia, consentirà ai terrestri di sviluppare nuove forme di viaggio spaziale. Sulla scia e l'espansione di questi sviluppi, diventerà realtà un fattore di viaggio e trasporto che, prima del 1995 e per molto nel futuro successivo, era descritto come fantasia e impossibilità, vale a dire il viaggio nel tempo ".

Billy:
È esattamente quello che pensavamo. Qui, ora ho un calcolo per il numero π. E’ tutto lavoro di Guido, come si può sicuramente già intuire dalla calligrafia. La domanda, ora, è se i calcoli sono concordanti e, quindi, sono accurati.”

Queste 23 pagine sono state immediatamente tradotte in inglese e conseguentemente pubblicate, cosa che apparentemente è stata notata in tutto il mondo da vari esperti di matematica e li ha motivati a esaminare intensamente il numero π e a scoprire l'errore. Fu quindi Guido Moosbrugger, membro del “Nucleo Centrale dei 49” (n.d.t.: KG49) , il primo a calcolare il corretto valore del π, come si evince dal seguente estratto di conversazione del febbraio 1998 in occasione del 260° contatto (" Rapporti di Contatto con i Plejaren", volume 7, pagina 483 e seguenti). La risposta di Ptaah deve essere interpretata di conseguenza come positiva e sarebbe andata diversamente se il risultato non fosse stato corretto. Come si può vedere dal calcolo sul manoscritto di Guido, esso si basa sulle dimensioni originali della piramide di Cheope:

 

passaggi matematici per il calcolo del Pi Greco (π)

Manoscritto di Guido Moosbrugger

 

passaggi matematici per il calcolo del Pi Greco (π)

Traduzione in lingua inglese del manoscritto di Guido Mosbrugger

 

 

Logica del calcolo:

g = spigolo di base = diametro della circonferenza inscritta nella base quadrata della piramide regolare quadrangolare (come la piramide di Cheope)

 

 

Ptaah:
Questo calcolo è davvero sorprendente, ma è ancora troppo presto per poter aggiungere informazioni più dettagliate e più precise al riguardo.

Billy:
temevamo questa risposta, ma volevamo solo provare.

Ptaah:
Certo, capisco, ma devo davvero attenermi a quanto detto. Se dovessi entrare più in dettaglio al riguardo, allora dovrei violare le nostre direttive, ma non lo facciamo.

 

Quanto sopra, per quanto riguarda gli estratti dai rapporti di contatto.

Ebbene, oltre che relativa a Guido Moosbrugger, l'informazione sul π contenuta nel 251° contatto era anche relativa al precursore Harry E. Lear, che, dopo un processo durato diversi anni, alla fine ha avuto successo, cioè nel confermare il corretto valore del numero π di 3.1446 ...! i suoi studi possono essere letti, visualizzati e ricalcolati o compresi da coloro che sono interessati sul suo sito web www.measuringpisquaringphi.com. A questo punto va menzionato un "esperimento speciale" come dimostrazione, perché è così originale e autoesplicativo che ci si chiede perché (per quanto ne so) nessuno lo abbia mai implementato prima. Harry Lear aveva tagliato con una macchina a controllo numerico (CNC) una ruota con un diametro esattamente di 1 metro, fresata da un pannello di legno composto da diversi strati incollati trasversalmente. Successivamente, ha misurato tale circonferenza per mezzo di un metro a nastro e ha documentato l'intero processo di misurazione in un video. Molto interessante e da vedere!

L'uso del numero π corretto, come ricordato da BEAM precedentemente, porterà a progressi inaspettati. Molte costanti relative al numero π devono essere riviste, quindi corretto, e tra le altre per esempio la “costante di Planck ridotta” (n.d.t.: ħ≡h/π) come mi disse Harry Lear, mentre questo termine non è altro che un cosiddetto “villaggio boemo” per me (n.d.t.: espressione che corrisponde a “mi è completamente sconosciuto”).

Nel frattempo Harry Lear ha contattato diversi scienziati, anche in Francia, dove “il chilogrammo originale”, una sfera di metallo, custodita a Parigi, deve essere sostituita da una di silicio. A questo proposito sono in corso gli esperimenti relativi. Si dice che il numero di atomi misurati nella sfera di silicio sia più stabile di quello nella sfera del chilogrammo originale in metallo, da cui gli atomi apparentemente "scompaiono" continuamente. E poiché il chilogrammo originale è la base per molte altre misure, ecc., è ovviamente cruciale se i calcoli a questo riguardo siano basati su un numero π corretto o errato.

Infine, vorrei sottolineare l'ostacolo a mio avviso più importante sulla strada per il riconoscimento del numero π corretto, ovvero la comunità scientifica! Come mi è stato detto da Harry Lear, le sue passate esperienze con 'l’establishment scientifico" suggeriscono che sarà un percorso difficile fino a quando questi autorevoli "amministratori della conoscenza" e “beneficiari e detentori di status” nelle istituzioni accademiche superiori non cambieranno idea e adotteranno quello che dovrebbe essere il compito principale degli scienziati, ovvero "creare conoscenza". “Creare conoscenza” significa essere costantemente aperti a nuove intuizioni e all'accettazione dei fatti, ovviamente dopo un esame giustamente imparziale, anche se ciò significa che ciò che fino ad ora è stato considerato generalmente valido debba essere rifiutato o, se necessario, rivisto. E se si considera il fatto che l'universo a noi visibile rappresenta solo una delle sette “cinture/stratificazioni” totali (n.d.t.: semplificando il concetto, come in una matrioska) della “Coscienza Universale della Creazione”, o che la struttura della materia dall'atomo in termini di dimensione o precisione “verso il basso” e fino alla sottile Energia Spirituale comprende un totale di sette livelli (n.d.t.: come detto precedentemente il numero sette ha una rilevanza particolare nella creazione), diventa quindi chiaro che gli scienziati e, in qualità di retroguardia, la società hanno ancora molta strada da fare. Ma è anche altrettanto chiaro che gli scienziati seguiranno questo percorso, semplicemente più velocemente o più lentamente, proprio in base alla loro rispettiva agilità correlata alla consapevolezza, ma anche in base alla velocità con cui viene applicato e impiegato il corretto valore del numero π.

 

Christian Frehner, Svizzera

 

 

 

 

 

DeutschInglese
Testo originale in tedesco Testo originale in inglese
 
 

Wer über eine höhere Schulbildung verfügt und/oder in einem technischen Bereich arbeitet, wurde im Rah-men seiner Ausbildung bzw. Tätigkeit mit der Pi-Zahl konfrontiert. Diese sogenannte ‹Kreiszahl›, die in For-meln als griechischer Buchstabe π (Pi) dargestellt wird, stellt das Verhältnis zwischen dem Umfang und dem Durchmesser eines Kreises dar und ist ein grundlegender Berechnungsfaktor in vielen technisch-physikalisch-wissenschaftlichen Bereichen, von der Architektur bis zur Astro- und Quantenphysik usw. Wer sich für die Geschichte dieser Zahl bzw. für die Zahl an sich interessiert, dem sei empfohlen, diesbezüglich selbst in einem Lexikon bzw. im Inter-netz die entsprechenden Informationen nachzuschla-gen.

Anyone who has a higher education and/or works in a technical field had as part of his/her education or activity been confronted with the number Pi. This so-called “circular ratio”, which is in for-mulas depicted by the Greek letter π (Pi), repre-sents the ratio between the circumference and the diameter of a circle and is a fundamental calcula-tion factor in many technical-physical-scientific fields, from architecture to astrophysics and quan-tum physics, etc. For those interested in the history of this number resp. the number itself, it is rec-ommended to themselves look up the respective information in a lexicon resp. on the Internet.

In der Mathematik und allgemein in den Technikwis-senschaften besteht Einigkeit darüber, dass die Kreiszahl Pi den Wert 3,1415... repräsentiert, wobei die drei Punkte darauf hinweisen, dass den vier Ziffern nach dem Komma noch viele weitere folgen. Konkret besagt die Kreiszahl Pi, dass bei einem Kreis von 1 Meter Durchmesser dessen Umfang 3,1415... Meter beträgt, was aber leider nicht stimmt, denn die-ser Wert ist falsch! – Aber es gibt gute Neuigkeiten: Die korrekte Kreiszahl, nämlich 3,1446..., wurde inzwischen ermittelt und deren Richtigkeit bewiesen, und zwar durch Harry E. Lear aus Idaho/USA. Seinen Besuch am 3.9.2017 im Semjase-Silver-Star-Center, zusammen mit seiner Ehefrau Nancy, nehme ich zum Anlass, die Vorgeschichte zu erläutern, die zu diesem – wissenschaftsgeschichtlich gesehen – denkwürdi-gen Ereignis bzw. Ergebnis geführt hat. Einmal mehr zeigt sich dabei, dass aufgrund von wertvollen und äusserst vielfältigen Informationen, die ‹Billy› Eduard A. Meier (BEAM) und seine plejarischen Freunde – wie übrigens auch andere zur Nokodemion-Geistformlinie belangende Persönlichkeiten – vermit-teln bzw. vermittelt haben, Bahnbrechendes ins Rol-len gebracht wurde, das der irdischen Menschheit bereits unermesslich viel Positives gebracht hat und noch weiterhin bringen wird.

In mathematics and generally in engineering sciences there is agreement that the circular ratio represents the value 3.1415..., whereby the three dots indicate, that the four digits after the dot are followed by many more. Specifically, the circular ratio Pi means that for a circle of 1 meter in diam-eter its circumference amounts to 3.1415... meters, which is however unfortunately incorrect, because this value is wrong! – But there is good news: The correct circular ratio, namely 3.1446..., has meanwhile been determined and its correct-ness proven, and actually by Harry E. Lear from Idaho/USA. I take the opportunity presented by his visit of 3 September 2017 to the Semjase-Silver-Star-Center, joined by his wife Nancy, to explain the past history, which has led to this – seen from a history of scientific perspective – memorable event resp. result. Once again it be-comes evident, that due to valuable and extremely diverse information, which “Billy” Eduard A. Meier (BEAM) and his Plejaren friends – same as by the way also other personalities belonging to the Nokodemion spirit form family – impart resp. have imparted, groundbreaking things had been set in motion, that have already brought and will continue to bring immeasurable positive outcomes.

Um den Ablauf zu schildern, der endlich zur Korrektur der Kreiszahl geführt hat, muss ich etwas weiter ausholen und beginne demzufolge mit dem 127. Kontaktbericht vom 3. Februar 1980 (PP Block 3, Seite 433 ff.):

in order to describe the sequence which had finally led to the correction of the circular ratio, I have to go a little farther and am therefore starting with the 127th contact report of 3rd February 1980 (“Pleiadean-Plejaren contact reports”, Block 3, page 433)

Billy:
Dann wird sich ja bald einiges ergeben. Nun aber noch eine Frage: Vor langer Zeit fragte ich dich einmal nach der Gesamtzahl aller Elemen-te im Universum. Damals sagtest du mir, dass du darüber keine Auskunft erteilen dürftest, es sei denn, wenn von den Erdenmenschen selbst die genaue Zahl herausgefunden werde. Nun dazu neuerlich die Frage nach der Elementan-zahl und ob es im Universum ein Gestirn gibt, wo diese Elemente alle vereint vorkommen?

Billy:
Then something will, indeed, soon arise. But now, another question: A long time ago, I once asked you for the total number of all elements in the universe. At that time, you told me that you wouldn't be allowed to give any information about that, unless the exact num-ber would be found out by the human beings of Earth themselves. Now, again to the question about the number of elements and whether there is a star in the universe, where all these elements are found together?

Semjase:
Ein solches Gestirn gibt es nicht, weil dies schöpfungsgesetzwidrig wäre

Semjase:
There is no such star, because that would be against the laws of Creation.

Billy:
Ah gut. Ist es richtig, dass die Gesamtzahl der Elemente deren 280 beträgt?

Billy:
Ah, good. Is it right that the total number of elements is 280?

Semjase:
Wie bist du auf dieses Resultat gestossen?

Semjase:
How did you come across this result?

Billy:
Das  war  nicht  ich,  mein  Kind,  sondern  Guido  (Anm.: Moosbrugger). Meinerseits habe ich nur errechnet, dass diese Zahl wohl der Richtigkeit entsprechen  muss,  weil  sich  nämlich  ergeben  hat,  dass  diese  Zahl,  multipliziert  in  sieben-facher Form mit der Ursprungshöhe der Gizeh-Pyramide, auf die Zehntelstelle genau die heu-tige Lichtgeschwindigkeit ergibt.

Billy:
It wasn't me, my child, but Guido. For my part, I've  only  calculated  that  this  number  must,  indeed,  correspond  to  the  correctness  because  it  has  been  found  that  this  number,  multiplied in a sevenfold form with the original height of the Giza Pyramid, results in the current speed of light to the tenths place exactly.

Semjase:
Du  bist  einfach  unfassbar.  Die  Zahl  der  Ele-mente     entspricht     nämlich     ebenso     der     Richtigkeit  wie  auch  deine  Berechnung  mit  der  siebenfachen   Multiplizierung   der   ursprüngli-chen  Pyramidenhöhe.  Das  Endresultat  ergibt  tatsächlich  die  exakte  Zahl  der  gegenwärtigen  Lichtkonstante.

Semjase:
You  are  simply  unbelievable.  The  number  of  the  elements  is  just  as  correct  as  also  your  calculation  with  the  sevenfold  multiplying  of  the  original  pyramid  height.  The  end  result  actually  yields  the  exact  number  of  the  present light constant.

Billy:
Wie  Guido  eigentlich  auf  die  Zahl  280  ges-tossen ist, das weiss ich nicht genau. Er hat mir nur   eine   Errechnungsformel   aufgeschrieben.   Wichtig  ist  dabei  aber  ja,  dass  die  Grundzahl  280   stimmt,   mit   der   ich   weiterrechnen   und   Überprüfungen  anstellen  konnte.  So  setzte  ich  zu  dieser  280  einfach  die  Pyramidenhöhezahl  und  multiplizierte  dann  das  Ergebnis  in  einmaliger  siebenfacher  Form,  woraus  sich  dann  das Ergebnis der Lichtgeschwindigkeit ergab.

Billy:
How  Guido  actually  came  across  the  number  280,  that  I  don't  know  exactly.  He  only  wrote  me a calculation formula. It's important there, however,  that  the  base  number  280  is  right,  with  which  I  could  calculate  further  and  do  some checks. So I simply applied the pyramid height number to this 280 and then multiplied the  result  in  a  unique  sevenfold  form,  from which  then  the  result  of  the  speed  of  light  arose.

Semjase:
Du  solltest  diese  Resultate  aber  noch  nicht  zu  sehr bekanntmachen.

Semjase:
You shouldn't make these results known too much yet, however.

Billy:
Meinst du, dass ich darüber schweigen soll?

Billy:
You mean that I should remain silent about it?

Semjase:
Sicher, wenigstens über die Zahlenwerte der wirklichen ursprünglichen Pyramidenhöhe. Diese ist den irdischen Wissenschaftlern bes-timmter Wissensgebiete bisher noch unbekannt, und es wäre nicht gut, wenn sie diese bereits jetzt in Erfahrung bringen würden. In zwei bis drei Jahren jedoch spielt das Bekanntwerden dieser Zahl keine grosse Rolle mehr. Bis dahin jedoch solltest du vorsichtig sein.

Semjase:
Sure, at least about the numerical values of the real original pyramid height. Up to now, this is still unknown to the terrestrial scien-tists of certain fields of knowledge, and it wouldn't be good if they would get to know these already now. In two to three years, however, this number being made known won't play a large role anymore. Until then, however, you should be careful.

Billy:
Bisher rechnen jene, welche sich mit diesen Dingen beschäftigen, mit völlig falschen Daten bezüglich der Pyramidenhöhe, woraus falsche Schlüsse und neue Falschresultate entstehen.

Billy:
So far, those who deal with these things reckon with completely incorrect data re-garding the pyramid height, resulting in false conclusions and new, incorrect results.

Semjase:
Sicher, doch sind alle diese Dinge sehr viel weitverzweigter, als du dir im Augenblick viel-leicht vorstellst. Die Daten der Pyramide reichen hinein bis in die Physik und in viele andere Wis-senschaften. Und diese Daten stellen Grundfor-meln dar für ganz bestimmte Berechnungen, die zu ungeheuren Erfindungen aller Art und zu gewaltigem Fortschritt führen. Würden diese Erfindungen und Fortschritte aber bereits jetzt durch das Verraten der wahrheitlichen Daten in die Wege geleitet, dann würde der bestimmte Evolutionsweg gestört, wodurch eine noch sehr viel grössere Katastrophe auf der Erde durch den Erdenmenschen ausgelöst würde, als dies vielleicht in kommender Zukunft der Fall sein wird. Die Nennung der wahrheitlichen Daten würde zu Berechnungen und Erkenntnissen führen, die den irdischen Wissenschaften Wege und Möglichkeiten wiesen, denen sie noch nicht Herr sind und die dadurch nur in einer rettungslosen Katastrophe enden könnten.

Semjase:
Sure, but all these things are much more widely branching than you might imagine at the moment. The data of the pyramid extend into physics and into many other sciences. And these data provide basic formulas for very specific calculations, which lead to tremendous inventions of all kinds and to enormous progress. But if these inventions and progresses would already be initiated now by revealing the true data, then the determined path of evolution would be disturbed, by what means an even very much greater catastrophe would be triggered on Earth by the human beings of Earth than what might be the case in the coming future. The mentioning of the true data would lead to calculations and insights that would point the terrestrial sciences to ways and possibilities, of which they are not yet master and which could, therefore, only end in a hopeless catastrophe.

Billy:
Ich verstehe, dann muss ich auf der Hut sein, dass nicht ein Gruppemitglied diese Daten aus-plaudert, denn ein oder zwei Personen kennen sie.

Billy:
I understand, then I must be on the alert that no group member divulges these data, because one or two persons know them.

Semjase:
Du musst sie unbedingt auf das erforderliche Schweigen hinweisen.

Semjase:
You absolutely must point them to the necessary silence.

Billy:
Werde ich tun. – Dies bezieht sich aber nur auf die Pyramidendaten, oder?

Billy:
I will do that. - But this only refers to the pyramid data, right?

Semjase:
Sicher, es handelt sich nur um diese.»
Viele Jahre später, am 19. Juni 1993 und während des 246. Kontaktgesprächs (PP Block 7, Seite 189 ff.), kam Billy auf obiges Gespräch erneut zu sprechen:

Semjase:
Sure, it only concerns that.”
Many years later, on 19th June 1993 and during the 246th contact conversation (“Pleiadean-Plejaren contact reports”, block 7, page 189ff.), Billy referred back to the conversation from above:

Billy:
Dann wiederum eine nächste Frage: Ihr habt mir einmal erklärt, dass im gesamten Universum deren 280 Elemente existierten – nachdem Gui-do durch Berechnungen darauf gestossen ist. Ich errechnete dann, dass die ursprüngliche Pyra-midenhöhe der Pyramide von Gizeh 152,955347 Meter betrug, was ihr mir bestätigt habt. Ihr sag-tet dazu auch, dass die heutige Höhe von rund 136,8 Metern dadurch entstanden sei, weil die alten Ägypter usw. dermassen viel Material von der Pyramide abgetragen hätten, dass sie eben dermassen geschrumpft sei. Nun, die irdischen Wissenschaftler behaupten, dass die grosse Gizeh-Pyramide ursprünglich 146,6 Meter Höhe gehabt habe, was aber meinen Berechnungen und euren Aussagen gemäss nicht der Wahrheit entspricht. Die ursprüngliche Höhe betrug tatsächlich 152,955347 Meter, was in Kilometer umbenannt auch genau der Distanz Erde-Sonne und somit also einer AE, einer Astronomischen Einheit entspricht. Eine Tatsache, die der un-genauen Distanzangabe von Erde-Sonne durch die irdisch-astronomische Wissenschaft wid-erspricht. Interessant ist nun die weitere Berech-nung, die ich damals angefertigt habe, und zwar nämlich, dass sich aus der genauen Pyra-midenhöhe resp. aus der genauen Distanz Erde-Sonne und mit der Zahl der gesamten Elemente von deren 280 die heutige und sehr genaue Lichtgeschwindigkeit ausrechnen lässt, wenn man den Multiplikationsfaktor 7 hinzuzieht. Die Rechnung lautet dann folgendermassen:

Billy:
Then again a next question: You once explained to me that in the entire universe 280 elements would exist – after Guido came across that by calculations. I then calculated that the original pyramid height of the Pyramid of Giza was 152.955347 meters, which you confirmed to me. You also said in that respect that today’s height of about 136.8 meters developed due to the fact that the an-cient Egyptians, etc., would have removed such an extent of material from the pyramid that it hence shrunk accordingly. Well, the terrestrial scientists claim that the Great Giza Pyramid originally had a height of 146.6 meters, which however, according to my calcu-lation and your statements, does not corre-spond to the truth. The original height actually amounted to 152.955347 meters, which, renamed into kilometers, also corresponds exactly to the distance Earth-Sun and thus hence to one au, one astronomical unit. A fact, which contradicts the inaccurate specifi-cation of Earth-Sun distance by the terrestrial-astronomical science. Interesting is now the additional calculation that I had made at that time, and namely, that it is possible to calcu-late today’s and the very precise speed of light from the precise pyramid height resp. from the precise distance Earth-Sun and with the total number of elements of the 280, if one includes the multiplication factor 7. The calculation reads then as follows:

280 x 7 = 1960 x 152,955347 = 299 792,48012

280 x 7 = 1960 x 152.955347 = 299 792.48012

Also ist das Endresultat die heutige Lichtgeschwindigkeit, die 299 Tausend und 792,48012 Kilometer pro Sekunde beträgt. Diese Rechnung durfte ich damals nicht öffentlich bekanntmachen, wie auch nicht die genaue Zahl der Elemente. Die Frage dazu ist nun die, ob diese von mir erstellten Berechnungen noch immer der Geheimhaltung unterliegen müssen oder ob man nun offen darüber sprechen darf?

So the final result is today’s speed of light, which is 299 thousands and 792.48012 kilo-metres per second. I was at that time not al-lowed to publicise this calculation nor the exact number of elements. The question now is, whether these calculations produced by me are still subject to nondisclosure, or whether it is now permissible to speak openly about it?

Ptaah:
Zur weiteren Geheimhaltung liegen keine Grün-de mehr vor.»

Ptaah:
There are no longer reasons for further non-disclosure.”

Am 3. Februar 1995 dann, während des 251. Kon-takts, fügte BEAM 23 Seiten mit Prophezeiungen und Voraussagen in den Kontaktbericht ein, wobei er wie folgt auf den Korrekturbedarf der ‹Pi-Zahl› hin-wies (PP Block 7, Seiten 336 und 340):

Then on 3rd February 1995, during the 251st con-tact, BEAM added 23 pages of prophecies and predictions into the contact report, while him refer-ring to the need for correction of the “Pi-number” as follows (“Pleiadean-Plejaren contact reports”, block 7, pages 336 and 340):

«... Dies alles geht einher mit vielen Neuer-ungen und Entdeckungen in der Technik und in den Wissenschaften, denn das Jahr 1995 und die folgenden Jahre bringen ungeheuer viele Durchbrüche zur Veränderung der Zivilisation. Dazu wird in kommender Zeit auch der Faktor dessen beitragen, dass endlich das Falsche in der Berechnung der Pi-Zahl erkannt und be-hoben wird. ... Erst jetzt wird eigentlich richtig erkannt, dass die Sonne ein sterbendes Gestirn und damit der Untergang des SOL-Systems bereits bestimmt ist, auch wenn die Sonne noch rund 4,1 Milliarden Jahre weiterbestehen wird, jedoch dann bereits als toter Stern, der dann nach dieser Zeit durch ein Schwarzes Loch verschluckt und vernichtet wird. Also be-ginnen die Wissenschaftler Höchstleistungen zu erbringen – und finden dabei die Feh-lberechnungen, die der Pi-Zahl zugrundeliegen. Durch die Behebung und nunmehrige Richtig-berechnung der Pi-Zahl werden die Wissen-schaftler und die ungemein hochentwickelte Technik fähig, unvorstellbare Energien für die Erde nutzbar zu machen, und zwar dadurch, indem es ihnen möglich wird, von Schwarzen Löchern im weiten Gebiet der Milchstrasse Energien abzuleiten und für die Erde nutzbar zu machen. Noch wird es aber zu dieser Zeit den Wissenschaftlern verwehrt sein, bis in das Zentrum unserer Galaxie vorzustossen, um auch das dortige Schwarze Loch anzuzapfen. Dies aber wird vorderhand auch nicht nötig sein, denn die umliegenden Objekte zur Ener-giegewinnung sind vollumfänglich ausreichend, um der Erde dienlich zu sein. Diese neue Ener-giegewinnung sowie die Art der Energie selbst, ermöglichen es fortan dem Erdenmenschen, neue Raumreiseformen zu entwickeln, in deren Folge und Erweiterung auch jener Reise- und Beförderungsfaktor Wirklichkeit wird, der im Jahre 1995 und alle Zeit zuvor sowie noch lange Zeit in die Zukunft als Phantasterei und Unmöglichkeit bezeichnet wird, nämlich die Zeitreise.»

“...These events coincide with many innova-tions and discoveries in technology and sci-ence; for 1995 and the ensuing years bring incredible breakthroughs that will change civi-lization. One contributing factor to these breakthroughs in the near future will be, final-ly, the exposure and rectification of an error in the Pi-number calculation...Only then will people correctly realize that the Sun is a dy-ing celestial body and that, subsequently, the end of the SOL system will herewith be pre-determined already. Nonetheless, the Sun will continue to exist another billion years, but by then it will be a dead star that will, ulti-mately, be swallowed up and destroyed by a Black Hole. Therefore, scientists will begin performing at feverish rates. In the process they will discover that the base for pi was miscalculated. By eliminating the error in pi, and correcting future computations based on pi, scientists and their amazing, highly devel-oped technology will have the capability to make unimaginable energies accessible to the people of Earth. This will be accomplished through the terrestrials' diversion and utilization of energies from Black Holes from within the Milky Way system. Scientists at this time, though, will still be unable to travel to the center of our galaxy to tap the existing Black Hole in that region. Still, it will be un-necessary to go to the center of our galaxy, at least at that particular time, for nearby ob-jects will produce sufficient energy to serve Earth's needs. This new energy source, in fact, the energy type itself, will enable terres-trials to develop new forms of space travel. In the wake and expansion of these developments, a travel and transportation factor becomes reality which, prior to 1995 and long into the future, had been called fantasy: Time travel.”

Diese 23 Seiten wurden umgehend ins Englische übersetzt und entsprechend veröffentlicht, was offen-bar weltweit diverse in Mathematik bewanderte Per-sonen wahrgenommen hatten und sie motivierte, sich mit der Kreiszahl Pi intensiv zu befassen und den Fehler herauszufinden. Es war dann das ‹Kerngruppe der 49›-Mitglied Guido Moosbrugger, der als erster die korrekte Pi-Zahl berechnete, wie aus folgendem Gesprächsauszug vom 3. Februar 1998 anlässlich des 260. Kontakts (PP Block 7, Seite 483 ff.) hervorgeht, wobei die Antwort seitens Ptaah entsprechend positiv zu interpretieren ist und bei einem vorliegenden falschen Ergebnis anders ausge-fallen wäre. Wie aus Guidos handschriftlich verfasster Berechnung hervorgeht, basiert diese auf den vorgängig genannten, ursprünglichen Massen der Cheops-Pyramide:

These 23 pages were immediately translated into English and published correspondingly, which ap-parently got noticed worldwide by diverse mathematics experts and motivated them to intensively look into the circular ratio Pi and to find out the error. It was then the “core group of the 49” mem-ber Guido Moosbrugger, who was the first to calculate the correct Pi-number, as is shown in the following extract of conversation of February 1998 on the occasion of the 260th contact (“Pleiadean-Plejaren contact reports”, block 7, page 483ff.), whereby the answer from Ptaah needs to be inter-preted accordingly positive and would have turned out differently in the case of a false result to hand. As is evident from Guido’s hand-written calculation, it is based on the earlier on mentioned origi-nal measurements of the Pyramid of Cheops:

Billy:
Das dachten wir uns eben. Hier habe ich nun eine Berechnung für die Kreiszahl Pi. Guidos Werk ist das Ganze, wie du ja sicher schon an der Handschrift ersiehst. Die Frage ist nun die, ob die Berechnungen stimmen und also zutreffend sind.

Billy:
That’s exactly what we thought. Here, I now have a calculation for the circle number pi. Guido’s work is the whole thing, as you can surely already tell by the handwriting. The question, now, is whether the calcula-tions agree and, thus, are accurate.

 

 

passaggi matematici per il calcolo del Pi Greco (π)

 

 

 

 

passaggi matematici per il calcolo del Pi Greco (π)

 

 

Ptaah:
Sehr erstaunlich, diese Berechnung, doch noch ist der Zeitpunkt viel zu früh, um darüber nähere und genauere Aussagen ma-chen zu dürfen.

Ptaah:
This calculation is very amazing, but the time is still much too early in order to be allowed to make more detailed and more exact statements about that.

Billy:
Diese Antwort haben wir schon befürch-tet, doch wir wollten es eben versuchen.

Billy:
We’ve already feared this answer, but we just wanted to try

Ptaah:
Natürlich, ich verstehe, doch muss ich wirklich bei meiner Aussage bleiben. Ginge ich näher darauf ein, dann müsste ich gegen un-sere Direktiven verstossen; solches aber tun wir nicht.»
Soweit die Auszüge aus den Kontaktberichten.

Ptaah:
Of course, I understand, but I really must remain with my statement. If I would go into more detail about that, then I would have to violate our directives, but we don’t do such.”
That much from the extracts of contact reports.

Nun, nebst Guido Moosbrugger war die Information zur Kreiszahl Pi im 251. Kontakt auch für Harry E. Lear der Initialfaktor, der nach einem mehrjährigen Prozess schliesslich zum Erfolg geführt hat, nämlich zur Bestätigung der korrekten Pi-Zahl von 3,1446...! Seine Beweisführungen können von interessierten Personen auf seiner Webseite (www.measuringpisquaringphi.com) gelesen, betrachtet und nachgerechnet bzw. nachvollzogen werden. Dabei sei ein ‹spezielle Experiment› zur Beweisführung an dieser Stelle besonders erwähnt, weil es derart originell und selbsterklärend ist, dass man sich fragt, warum noch (meines Wissens) nie-mand zuvor dieses in die Tat umgesetzt hat. Harry Lear liess nämlich auf einer CNC-Maschine ein Rad von genau 1 Meter Durchmesser aus einer aus mehreren kreuzweise verleimten Schichten beste-henden Holzplatte herausfräsen. Danach mass er dessen Umfang mittels eines Massbands und doku-mentierte den ganzen Messprozess in einem Video. Höchst interessant und anschauenswert!

Well, besides for Guido Moosbrugger, the information on the circular ratio Pi in the 251° contact was also for Harry E. Lear the initial factor, which finally led to success after a multi-year process, namely to the confirmation of the correct Pi-number of 3.1446...! His reasoning can on its website (www.measuringpisquaringphi.com) be read, viewed and recalculated by interested persons. Thereby at this occasion a “special experiment” for the purpose of the reasoning may be particularly mentioned, because it is so original and self-explanatory that one wonders, why (to my knowledge) no one has ever put this into practice yet. Harry Lear had namely a CNC machine cut-ting out a wheel of exactly 1 meter diameter of a wooden plate consisting of several crosswise glued layers. After that, he measured its circum-ference by means of a measuring tape and documented the whole measuring process in a video. Very interesting and worthy to watch!

Die Verwendung der korrekten Pi-Zahl wird, wie von BEAM weiter oben erwähnt, zu ungeahnten Fortschritten führen. Viele mit der Pi-Zahl in Verbindung stehende Konstanten müssen überarbeitet bzw. korrigiert werden, unter anderen beispielsweise das ‹Plancksches Wirkungsquan-tum›, wie mir Harry Lear gesagt hat, wobei dieser Begriff mir selbst ein sogenannt ‹böhmisches Dorf› ist. Inzwischen hat Harry Lear diverse Wissenschaft-ler kontaktiert, u.a. auch in Frankreich, wo das in Paris lagernde ‹Ur-Kilogramm›, eine Metallkugel, durch eine Kugel aus Silizium ersetzt werden soll. Diesbezüglich laufen entsprechende Experimente. Die gemessene Anzahl der Atome in der Siliziumku-gel soll stabiler sein als jene in der bisherigen Ur-Kilogramm-Kugel, aus der offenbar laufend Atome ‹verschwinden›. Und da das Ur-Kilogramm die Basis ist für viele andere Masse usw., ist es natürlich entscheidend, ob diesbezügliche Berechnungen auf einer korrekten oder falschen Pi-Zahl basieren.

The use of the correct Pi-number will, as men-tioned by BEAM further above, lead to unsuspect-ed advances. Many constants related to the Pi-number have to be revised resp. corrected, be-sides others for example the “reduced Planck con-stant”, as Harry Lear told me, while this term is nothing but a so-called “Bohemian village” to me. Meanwhile Harry Lear has contacted various sci-entists, among others also in France, where the “ur-kilogram”, a metal ball stored in Paris, is to be replaced by a ball of silicon. In this regard, corre-sponding experiments are carried out. The meas-ured number of atoms in the silicon ball is sup-posed to be more stable than the one of the origi-nal ur-kilogram-ball, from which atoms are appar-ently constantly “disappearing”. And since the ur-kilogram is the basis for many other measures, etc., it is of course crucial, whether respective cal-culations are based on a correct or false Pi-number.

Abschliessend sei auf das meines Erachtens grösste Hindernis auf dem Weg zur Anerkennung der korrekten Pi- bzw. Kreiszahl hingewiesen, nämlich der Wissenschaftsbetrieb! Wie mir von Harry Lear geschil-dert wurde, lassen seine bisherigen Erfahrungen mit dem ‹wissenschaftlichen Establishment› nämlich darauf schliessen, dass es ein zäher Weg sein wird, bis sich die massgebenden ‹Wissensverwalter› und ‹Pfründe-und-Status-Bewahrer› in den höheren Lehrstätten umbesinnen und sich das zu eigen ma-chen, was die Kernaufgabe von Wissenschaftlern sein sollte, nämlich ‹Wissen zu schaffen›. Ein ‹Wissen-Schaffen› bedeutet ein ständiges Offensein für neue Erkenntnisse und die Akzeptanz von Fakten – natürlich nach entsprechend unvoreingenommener Prüfung –, und zwar auch dann wenn dies bedeutet, dass bisher als allgemeingültig Betrachtetes verworfen bzw. allen-falls revidiert werden muss. Und wird dabei die Tatsa-che betrachtet, dass das uns sichtbare Universum ledi-glich einen von insgesamt sieben Gürteln der ‹Schöpfung Universalbewusstsein› darstellt, oder dass der Materieaufbau vom Atom grössen- bzw. fein-heitsmässig ‹abwärts› und bis zur feinststofflichen Geistenergie insgesamt sieben Stufen umfasst, dann wird klar, dass die Wissenschaftler und als Nachhut die Gesellschaft noch einen sehr langen Weg zu gehen haben. Aber klar ist auch, dass die Wissen-schaftler diesen Weg gehen werden, einfach rascher oder langsamer, je nach deren entsprechend bewusst-seinsmässigen Beweglichkeit, und ebenfalls je na-chdem, wie rasch die korrekte Wirkungszahl Pi an-gewendet wird.

Finally, I would like to point out the in my opinion most important obstacle on the way to the recog-nition of the correct Pi-number resp. circular ratio, namely the scientific community! As I have been told by Harry Lear, his past experiences with the “scientific establishment” suggest that it will be a tough journey until the authoritative “knowledge administrators” and “sinecures-and-status-preservers” in the higher academic institutions change their mind and adopt what should be the core task of scientists, namely “to create knowledge”. A “knowledge-creation” means a constant open-mindedness for new cognitions and the acceptance of facts – of course, after a corresponding unbiased examination –, and actu-ally even then, if this means that things so far considered as generally accepted have to be dis-carded resp. revised at best. And when consider-ing the fact that the universe visible to us is merely representing one of a total of seven belts of the “Creation Universal Consciousness”, or that the composition of matter from the atom size- and fineness-wise “downwards” until the high-fine-fluidal spirit-energy comprises in totality sev-en levels, then it becomes clear that the scien-tists and as rearguard the society have still a very long way to go. However, it is also clear that the scientists will follow this path, simply faster or slower, just according to their respective con-sciousness-related agility, and also depending on how quickly the correct effect-number Pi is applied.

Christian Frehner, Schweiz Christian Frehner, Switzerland

 

 

Traduzione: Roberto Guidolin
Controllo: Emilio Zandarin